View larger

ODZ1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of ODZ1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00010178-A01
Product name:	ODZ1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant ODZ1.
Gene id:	10178
Gene name:	ODZ1
Gene alias:	ODZ3\|TEN-M1\|TNM\|TNM1
Gene description:	odz, odd Oz/ten-m homolog 1(Drosophila)
Genbank accession:	NM_014253
Immunogen:	ODZ1 (NP_055068, 2616 a.a. ~ 2725 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Protein accession:	NP_055068
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (38.21 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice