Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZNF256 monoclonal antibody (M02), clone 2H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about ZNF256 monoclonal antibody (M02), clone 2H6
| Brand: | Abnova |
| Reference: | H00010172-M02 |
| Product name: | ZNF256 monoclonal antibody (M02), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF256. |
| Clone: | 2H6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10172 |
| Gene name: | ZNF256 |
| Gene alias: | BMZF-3|BMZF3 |
| Gene description: | zinc finger protein 256 |
| Genbank accession: | NM_005773 |
| Immunogen: | ZNF256 (NP_005764.2, 521 a.a. ~ 627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CNECGKFFSQSSSLIRHRRSHTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGERPYECSDCGKFFTFNSNLLKHQNVHKG |
| Protein accession: | NP_005764.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |