Brand: | Abnova |
Reference: | H00010172-M01 |
Product name: | ZNF256 monoclonal antibody (M01), clone 3H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF256. |
Clone: | 3H7 |
Isotype: | IgG2a Kappa |
Gene id: | 10172 |
Gene name: | ZNF256 |
Gene alias: | BMZF-3|BMZF3 |
Gene description: | zinc finger protein 256 |
Genbank accession: | NM_005773 |
Immunogen: | ZNF256 (NP_005764.2, 521 a.a. ~ 627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CNECGKFFSQSSSLIRHRRSHTGERPYECSECWKSFSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNLTNHQRIHSGERPYECSDCGKFFTFNSNLLKHQNVHKG |
Protein accession: | NP_005764.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNF256 is approximately 0.3ng/ml as a capture antibody. |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |