CHST4 monoclonal antibody (M10), clone 4D7 View larger

CHST4 monoclonal antibody (M10), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHST4 monoclonal antibody (M10), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about CHST4 monoclonal antibody (M10), clone 4D7

Brand: Abnova
Reference: H00010164-M10
Product name: CHST4 monoclonal antibody (M10), clone 4D7
Product description: Mouse monoclonal antibody raised against a partial recombinant CHST4.
Clone: 4D7
Isotype: IgG2b Kappa
Gene id: 10164
Gene name: CHST4
Gene alias: LSST
Gene description: carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
Genbank accession: NM_005769
Immunogen: CHST4 (NP_005760, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAF
Protein accession: NP_005760
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010164-M10-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CHST4 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy CHST4 monoclonal antibody (M10), clone 4D7 now

Add to cart