Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDZK1IP1 monoclonal antibody (M06), clone 4D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about PDZK1IP1 monoclonal antibody (M06), clone 4D11
| Brand: | Abnova |
| Reference: | H00010158-M06 |
| Product name: | PDZK1IP1 monoclonal antibody (M06), clone 4D11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PDZK1IP1. |
| Clone: | 4D11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10158 |
| Gene name: | PDZK1IP1 |
| Gene alias: | DD96|MAP17|RP1-18D14.5|SPAP |
| Gene description: | PDZK1 interacting protein 1 |
| Genbank accession: | NM_005764.3 |
| Immunogen: | PDZK1IP1 (NP_005755.1, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM |
| Protein accession: | NP_005755.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.6 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PDZK1IP1 monoclonal antibody (M06), clone 4D11. Western Blot analysis of PDZK1IP1 expression in human kidney. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |