| Brand: | Abnova |
| Reference: | H00010155-M01 |
| Product name: | TRIM28 monoclonal antibody (M01), clone 4E6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM28. |
| Clone: | 4E6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10155 |
| Gene name: | TRIM28 |
| Gene alias: | FLJ29029|KAP1|RNF96|TF1B|TIF1B |
| Gene description: | tripartite motif-containing 28 |
| Genbank accession: | BC004978 |
| Immunogen: | TRIM28 (AAH04978, 379 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER |
| Protein accession: | AAH04978 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.69 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Multipotent Adult Germline Stem Cells and Embryonic Stem Cells Functional Proteomics Revealed an Important Role of Eukaryotic Initiation Factor 5A (Eif5a) in Stem Cell Differentiation.Dihazi H, Dihazi GH, Jahn O, Meyer S, Nolte J, Asif AR, Mueller GA, Engel W. J Proteome Res. 2011 Feb 24. [Epub ahead of print] |