Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MBNL2 monoclonal antibody (M01), clone 3C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about MBNL2 monoclonal antibody (M01), clone 3C3
| Reference: | H00010150-M01 |
| Product name: | MBNL2 monoclonal antibody (M01), clone 3C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MBNL2. |
| Clone: | 3C3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10150 |
| Gene name: | MBNL2 |
| Gene alias: | DKFZp781H1296|MBLL|MBLL39|MGC120625|MGC120626|MGC120628|PRO2032 |
| Gene description: | muscleblind-like 2 (Drosophila) |
| Genbank accession: | NM_144778 |
| Immunogen: | MBNL2 (NP_659002.1, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLE |
| Protein accession: | NP_659002.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |