ELA3A purified MaxPab rabbit polyclonal antibody (D01P) View larger

ELA3A purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELA3A purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about ELA3A purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00010136-D01P
Product name: ELA3A purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ELA3A protein.
Gene id: 10136
Gene name: ELA3A
Gene alias: ELA3
Gene description: elastase 3A, pancreatic
Genbank accession: NM_005747.3
Immunogen: ELA3A (NP_005738.3, 1 a.a. ~ 270 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH
Protein accession: NP_005738.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010136-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ELA3A expression in transfected 293T cell line (H00010136-T02) by ELA3A MaxPab polyclonal antibody.

Lane 1: ELA3A transfected lysate(29.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ELA3A purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart