Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00010124-B01P |
Product name: | ARL4A purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ARL4A protein. |
Gene id: | 10124 |
Gene name: | ARL4A |
Gene alias: | ARL4 |
Gene description: | ADP-ribosylation factor-like 4A |
Genbank accession: | BC001111 |
Immunogen: | ARL4A (AAH01111, 1 a.a. ~ 200 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
Protein accession: | AAH01111 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ARL4A expression in transfected 293T cell line (H00010124-T01) by ARL4A MaxPab polyclonal antibody. Lane 1: ARL4A transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |