Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 174,99 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 174,99 €
Data sheet of ARL4A purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about ARL4A purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00010124-B01P |
| Product name: | ARL4A purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ARL4A protein. |
| Gene id: | 10124 |
| Gene name: | ARL4A |
| Gene alias: | ARL4 |
| Gene description: | ADP-ribosylation factor-like 4A |
| Genbank accession: | BC001111 |
| Immunogen: | ARL4A (AAH01111, 1 a.a. ~ 200 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR |
| Protein accession: | AAH01111 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ARL4A expression in transfected 293T cell line (H00010124-T01) by ARL4A MaxPab polyclonal antibody. Lane 1: ARL4A transfected lysate(22.11 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |