Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ACTR1B monoclonal antibody (M05), clone 4E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA |
More info about ACTR1B monoclonal antibody (M05), clone 4E10
| Brand: | Abnova |
| Reference: | H00010120-M05 |
| Product name: | ACTR1B monoclonal antibody (M05), clone 4E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACTR1B. |
| Clone: | 4E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10120 |
| Gene name: | ACTR1B |
| Gene alias: | ARP1B|CTRN2|PC3 |
| Gene description: | ARP1 actin-related protein 1 homolog B, centractin beta (yeast) |
| Genbank accession: | NM_005735 |
| Immunogen: | ACTR1B (NP_005726, 191 a.a. ~ 286 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SRYLRLLLRKEGVDFHTSAEFEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHK* |
| Protein accession: | NP_005726 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to ACTR1B on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |