No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010110-M13 |
Product name: | SGK2 monoclonal antibody (M13), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SGK2. |
Clone: | 1G11 |
Isotype: | IgG2a Kappa |
Gene id: | 10110 |
Gene name: | SGK2 |
Gene alias: | H-SGK2|dJ138B7.2 |
Gene description: | serum/glucocorticoid regulated kinase 2 |
Genbank accession: | NM_016276 |
Immunogen: | SGK2 (NP_057360, 244 a.a. ~ 344 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFL |
Protein accession: | NP_057360 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to SGK2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |