| Brand: | Abnova |
| Reference: | H00010110-M05 |
| Product name: | SGK2 monoclonal antibody (M05), clone 4G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SGK2. |
| Clone: | 4G4 |
| Isotype: | IgG3 Kappa |
| Gene id: | 10110 |
| Gene name: | SGK2 |
| Gene alias: | H-SGK2|dJ138B7.2 |
| Gene description: | serum/glucocorticoid regulated kinase 2 |
| Genbank accession: | BC065511 |
| Immunogen: | SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC |
| Protein accession: | AAH65511 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SGK2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |