Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 750,35 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 750,35 €
Data sheet of ARPC2 monoclonal antibody (M01), clone 5C8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about ARPC2 monoclonal antibody (M01), clone 5C8
| Brand: | Abnova |
| Reference: | H00010109-M01 |
| Product name: | ARPC2 monoclonal antibody (M01), clone 5C8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant ARPC2. |
| Clone: | 5C8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10109 |
| Gene name: | ARPC2 |
| Gene alias: | ARC34|PNAS-139|PRO2446|p34-Arc |
| Gene description: | actin related protein 2/3 complex, subunit 2, 34kDa |
| Genbank accession: | BC000590 |
| Immunogen: | ARPC2 (AAH00590, 1 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR |
| Protein accession: | AAH00590 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (58.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ARPC2 monoclonal antibody (M01), clone 5C8 Western Blot analysis of ARPC2 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |