| Brand: | Abnova |
| Reference: | H00010084-M15 |
| Product name: | PQBP1 monoclonal antibody (M15), clone 3H7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PQBP1. |
| Clone: | 3H7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10084 |
| Gene name: | PQBP1 |
| Gene alias: | MRX55|MRXS3|MRXS8|NPW38|RENS1|SHS |
| Gene description: | polyglutamine binding protein 1 |
| Genbank accession: | BC012358 |
| Immunogen: | PQBP1 (AAH12358, 1 a.a. ~ 265 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD |
| Protein accession: | AAH12358 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PQBP1 is 0.03 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |