Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PQBP1 monoclonal antibody (M01), clone 1A11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PQBP1 monoclonal antibody (M01), clone 1A11
| Brand: | Abnova |
| Reference: | H00010084-M01 |
| Product name: | PQBP1 monoclonal antibody (M01), clone 1A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PQBP1. |
| Clone: | 1A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10084 |
| Gene name: | PQBP1 |
| Gene alias: | MRX55|MRXS3|MRXS8|NPW38|RENS1|SHS |
| Gene description: | polyglutamine binding protein 1 |
| Genbank accession: | NM_005710 |
| Immunogen: | PQBP1 (NP_005701, 184 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD |
| Protein accession: | NP_005701 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PQBP1 expression in transfected 293T cell line by PQBP1 monoclonal antibody (M01), clone 1A11. Lane 1: PQBP1 transfected lysate(30.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | RNA and protein interactors with TDP-43 in human spinal cord lysates in ALS.Volkening K, Keller B, Leysta-Lantz C, Strong MJ. J Proteome Res. 2018 Apr 6;17(4):1712-1729. doi: 10.1021/acs.jproteome.8b00126. Epub 2018 Mar 22. |