Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ATP9A monoclonal antibody (M02), clone 3G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re |
More info about ATP9A monoclonal antibody (M02), clone 3G2
| Brand: | Abnova |
| Reference: | H00010079-M02 |
| Product name: | ATP9A monoclonal antibody (M02), clone 3G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP9A. |
| Clone: | 3G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10079 |
| Gene name: | ATP9A |
| Gene alias: | ATPIIA|KIAA0611 |
| Gene description: | ATPase, class II, type 9A |
| Genbank accession: | NM_006045 |
| Immunogen: | ATP9A (NP_006036, 358 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRV |
| Protein accession: | NP_006036 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to ATP9A on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Proton myo-inositol cotransporter is a novel γ-secretase associated protein that regulates Aβ production without affecting Notch cleavage.Yasuhiro Teranishi, Mitsuhiro Inoue, Natsuko Goto Yamamoto, Takahiro Kihara, Birgitta Wiehager, Taizo Ishikawa, Bengt Winblad, Sophia Schedin-Weiss, Susanne Frykman and Lars O. Tjernberg. FEBS J. 2015 Jun 20. [Epub ahead of print] |