| Brand: | Abnova |
| Reference: | H00010077-M04 |
| Product name: | TSPAN32 monoclonal antibody (M04), clone 2G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSPAN32. |
| Clone: | 2G12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10077 |
| Gene name: | TSPAN32 |
| Gene alias: | FLJ17158|FLJ97586|MGC22455|PHEMX|PHMX|TSSC6 |
| Gene description: | tetraspanin 32 |
| Genbank accession: | NM_005705 |
| Immunogen: | TSPAN32 (NP_005696, 194 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD |
| Protein accession: | NP_005696 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TSPAN32 monoclonal antibody (M04), clone 2G12. Western Blot analysis of TSPAN32 expression in Hela S3 NE(Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |