SCAMP3 monoclonal antibody (M01), clone 1F6 View larger

SCAMP3 monoclonal antibody (M01), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCAMP3 monoclonal antibody (M01), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SCAMP3 monoclonal antibody (M01), clone 1F6

Brand: Abnova
Reference: H00010067-M01
Product name: SCAMP3 monoclonal antibody (M01), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant SCAMP3.
Clone: 1F6
Isotype: IgG1 Kappa
Gene id: 10067
Gene name: SCAMP3
Gene alias: C1orf3
Gene description: secretory carrier membrane protein 3
Genbank accession: NM_005698
Immunogen: SCAMP3 (NP_005689, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYY
Protein accession: NP_005689
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010067-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00010067-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SCAMP3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCAMP3 monoclonal antibody (M01), clone 1F6 now

Add to cart