Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of COX17 monoclonal antibody (M01), clone 4G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about COX17 monoclonal antibody (M01), clone 4G2
| Brand: | Abnova |
| Reference: | H00010063-M01 |
| Product name: | COX17 monoclonal antibody (M01), clone 4G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COX17. |
| Clone: | 4G2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10063 |
| Gene name: | COX17 |
| Gene alias: | MGC104397|MGC117386 |
| Gene description: | COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) |
| Genbank accession: | NM_005694 |
| Immunogen: | COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI |
| Protein accession: | NP_005685 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to COX17 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Dysregulation of intracellular copper homeostasis is common to transgenic mice expressing human mutant superoxide dismutase-1s regardless of their copper-binding abilities.Tokuda E, Okawa E, Watanabe S, Ono SI, Marklund SL. Neurobiol Dis. 2013 Jan 13. doi:pii: S0969-9961(13)00013-2. 10.1016/j.nbd.2013.01.001. [Epub ahead of print] |