ABCF2 MaxPab rabbit polyclonal antibody (D01) View larger

ABCF2 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCF2 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIP

More info about ABCF2 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00010061-D01
Product name: ABCF2 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human ABCF2 protein.
Gene id: 10061
Gene name: ABCF2
Gene alias: ABC28|DKFZp586K1823|EST133090|HUSSY-18|HUSSY18|M-ABC1
Gene description: ATP-binding cassette, sub-family F (GCN20), member 2
Genbank accession: NM_007189
Immunogen: ABCF2 (NP_009120.1, 1 a.a. ~ 623 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHMHNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQSKEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV
Protein accession: NP_009120.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00010061-D01-31-15-1.jpg
Application image note: Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ABCF2 MaxPab mouse polyclonal antibody (B01) (H00010061-B01).
Applications: IP
Shipping condition: Dry Ice

Reviews

Buy ABCF2 MaxPab rabbit polyclonal antibody (D01) now

Add to cart