Cart 70 Product Products 24 426,67 € (empty)
No products
To be determined Shipping
24 426,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 70 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 24 426,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 24 426,67 €
Data sheet of FARSLB polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about FARSLB polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00010056-A02 |
| Product name: | FARSLB polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant FARSLB. |
| Gene id: | 10056 |
| Gene name: | FARSB |
| Gene alias: | FARSLB|FRSB|HSPC173|PheHB|PheRS |
| Gene description: | phenylalanyl-tRNA synthetase, beta subunit |
| Genbank accession: | NM_005687 |
| Immunogen: | FARSLB (NP_005678, 234 a.a. ~ 341 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVI |
| Protein accession: | NP_005678 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |