Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00010055-B01P |
Product name: | SAE1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SAE1 protein. |
Gene id: | 10055 |
Gene name: | SAE1 |
Gene alias: | AOS1|FLJ3091|HSPC140|SUA1 |
Gene description: | SUMO1 activating enzyme subunit 1 |
Genbank accession: | NM_005500 |
Immunogen: | SAE1 (NP_005491.1, 1 a.a. ~ 346 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK |
Protein accession: | NP_005491.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SAE1 expression in transfected 293T cell line (H00010055-T01) by SAE1 MaxPab polyclonal antibody. Lane 1: SAE1 transfected lysate(38.06 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |