| Brand: | Abnova |
| Reference: | H00010044-M07A |
| Product name: | SH2D3C monoclonal antibody (M07A), clone 3C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH2D3C. |
| Clone: | 3C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10044 |
| Gene name: | SH2D3C |
| Gene alias: | CHAT|FLJ39664|NSP3|PRO34088 |
| Gene description: | SH2 domain containing 3C |
| Genbank accession: | NM_005489 |
| Immunogen: | SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI |
| Protein accession: | NP_005480 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SH2D3C monoclonal antibody (M07A), clone 3C5 Western Blot analysis of SH2D3C expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |