| Brand: | Abnova |
| Reference: | H00010025-M02 |
| Product name: | THRAP5 monoclonal antibody (M02), clone 2B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant THRAP5. |
| Clone: | 2B7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10025 |
| Gene name: | MED16 |
| Gene alias: | DRIP92|THRAP5|TRAP95 |
| Gene description: | mediator complex subunit 16 |
| Genbank accession: | BC017282 |
| Immunogen: | THRAP5 (AAH17282, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM |
| Protein accession: | AAH17282 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to THRAP5 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |