THRAP5 polyclonal antibody (A01) View larger

THRAP5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of THRAP5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about THRAP5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00010025-A01
Product name: THRAP5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant THRAP5.
Gene id: 10025
Gene name: MED16
Gene alias: DRIP92|THRAP5|TRAP95
Gene description: mediator complex subunit 16
Genbank accession: BC017282
Immunogen: THRAP5 (AAH17282, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM
Protein accession: AAH17282
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00010025-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy THRAP5 polyclonal antibody (A01) now

Add to cart