| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00010017-M03 |
| Product name: | BCL2L10 monoclonal antibody (M03), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BCL2L10. |
| Clone: | 1B11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 10017 |
| Gene name: | BCL2L10 |
| Gene alias: | BCL-B|Boo|Diva|MGC129810|MGC129811 |
| Gene description: | BCL2-like 10 (apoptosis facilitator) |
| Genbank accession: | NM_020396 |
| Immunogen: | BCL2L10 (NP_065129, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP |
| Protein accession: | NP_065129 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of BCL2L10 expression in transfected 293T cell line by BCL2L10 monoclonal antibody (M03), clone 1B11. Lane 1: BCL2L10 transfected lysate(23.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |