Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 158,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 158,00 €
Data sheet of BCL2L10 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about BCL2L10 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010017-A01 |
| Product name: | BCL2L10 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BCL2L10. |
| Gene id: | 10017 |
| Gene name: | BCL2L10 |
| Gene alias: | BCL-B|Boo|Diva|MGC129810|MGC129811 |
| Gene description: | BCL2-like 10 (apoptosis facilitator) |
| Genbank accession: | NM_020396 |
| Immunogen: | BCL2L10 (NP_065129, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP |
| Protein accession: | NP_065129 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Subcellular dynamics of the maternal cell death regulator BCL2L10 in human preimplantation embryos.Guerin JF, Cornut-Thibaut A, Giscard-Destaing S, Pouvreau S, Guillemin Y, Aouacheria A. Hum Reprod. 2013 Jan 4. |