No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00010014-M01 |
Product name: | HDAC5 monoclonal antibody (M01), clone 4G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HDAC5. |
Clone: | 4G2 |
Isotype: | IgG1 Kappa |
Gene id: | 10014 |
Gene name: | HDAC5 |
Gene alias: | FLJ90614|HD5|NY-CO-9 |
Gene description: | histone deacetylase 5 |
Genbank accession: | BC051824 |
Immunogen: | HDAC5 (AAH51824, 330 a.a. ~ 429 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG |
Protein accession: | AAH51824 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to HDAC5 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |