No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00010014-M01 |
| Product name: | HDAC5 monoclonal antibody (M01), clone 4G2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HDAC5. |
| Clone: | 4G2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10014 |
| Gene name: | HDAC5 |
| Gene alias: | FLJ90614|HD5|NY-CO-9 |
| Gene description: | histone deacetylase 5 |
| Genbank accession: | BC051824 |
| Immunogen: | HDAC5 (AAH51824, 330 a.a. ~ 429 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AENGFTGSVPNIPTEMLPQHRALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLG |
| Protein accession: | AAH51824 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to HDAC5 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |