Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 455,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 455,00 €
Data sheet of TANK MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about TANK MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00010010-B01 |
| Product name: | TANK MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TANK protein. |
| Gene id: | 10010 |
| Gene name: | TANK |
| Gene alias: | I-TRAF|TRAF2 |
| Gene description: | TRAF family member-associated NFKB activator |
| Genbank accession: | BC003388 |
| Immunogen: | TANK (AAH03388, 1 a.a. ~ 119 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI |
| Protein accession: | AAH03388 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TANK expression in transfected 293T cell line (H00010010-T01) by TANK MaxPab polyclonal antibody. Lane1:TANK transfected lysate(13.2 KDa). Lane 2:Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |