Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 662,33 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 662,33 €
Data sheet of TANK polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about TANK polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00010010-A01 |
| Product name: | TANK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant TANK. |
| Gene id: | 10010 |
| Gene name: | TANK |
| Gene alias: | I-TRAF|TRAF2 |
| Gene description: | TRAF family member-associated NFKB activator |
| Genbank accession: | BC003388 |
| Immunogen: | TANK (AAH03388.1, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI |
| Protein accession: | AAH03388.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |