Cart 9 Product Products 3 046,85 € (empty)
No products
To be determined Shipping
3 046,85 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 046,85 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 046,85 €
Data sheet of ACOT8 monoclonal antibody (M03), clone 3F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ACOT8 monoclonal antibody (M03), clone 3F1
| Brand: | Abnova |
| Reference: | H00010005-M03 |
| Product name: | ACOT8 monoclonal antibody (M03), clone 3F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ACOT8. |
| Clone: | 3F1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 10005 |
| Gene name: | ACOT8 |
| Gene alias: | HNAACTE|PTE-2|PTE1|PTE2|hACTE-III|hTE |
| Gene description: | acyl-CoA thioesterase 8 |
| Genbank accession: | NM_005469 |
| Immunogen: | ACOT8 (NP_005460.2, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYI |
| Protein accession: | NP_005460.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ACOT8 monoclonal antibody (M03), clone 3F1. Western Blot analysis of ACOT8 expression in A-431(Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |