| Brand: | Abnova |
| Reference: | H00010000-M04 |
| Product name: | AKT3 monoclonal antibody (M04), clone 4C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant AKT3. |
| Clone: | 4C1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 10000 |
| Gene name: | AKT3 |
| Gene alias: | DKFZp434N0250|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2 |
| Gene description: | v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
| Genbank accession: | AF124141 |
| Immunogen: | AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE |
| Protein accession: | AAD29089 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | AKT3 monoclonal antibody (M04), clone 4C1 Western Blot analysis of AKT3 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |