Cart 9 Product Products 3 793,36 € (empty)
No products
To be determined Shipping
3 793,36 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 793,36 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 793,36 €
Data sheet of AKT3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about AKT3 polyclonal antibody (A01)
| Reference: | H00010000-A01 |
| Product name: | AKT3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant AKT3. |
| Gene id: | 10000 |
| Gene name: | AKT3 |
| Gene alias: | DKFZp434N0250|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2 |
| Gene description: | v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) |
| Genbank accession: | AF124141 |
| Immunogen: | AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE |
| Protein accession: | AAD29089 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |