Brand: | Abnova |
Reference: | H00009991-A01 |
Product name: | ROD1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ROD1. |
Gene id: | 9991 |
Gene name: | ROD1 |
Gene alias: | DKFZp781I1117|PTBP3 |
Gene description: | ROD1 regulator of differentiation 1 (S. pombe) |
Genbank accession: | NM_005156 |
Immunogen: | ROD1 (NP_005147, 16 a.a. ~ 114 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY |
Protein accession: | NP_005147 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ROD1 polyclonal antibody (A01), Lot # 060525JCS1 Western Blot analysis of ROD1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |