Cart 1 Product Products 374,00 € (empty)
No products
To be determined Shipping
374,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of ROD1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ROD1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009991-A01 |
| Product name: | ROD1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ROD1. |
| Gene id: | 9991 |
| Gene name: | ROD1 |
| Gene alias: | DKFZp781I1117|PTBP3 |
| Gene description: | ROD1 regulator of differentiation 1 (S. pombe) |
| Genbank accession: | NM_005156 |
| Immunogen: | ROD1 (NP_005147, 16 a.a. ~ 114 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY |
| Protein accession: | NP_005147 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ROD1 polyclonal antibody (A01), Lot # 060525JCS1 Western Blot analysis of ROD1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |