Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC12A6 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SLC12A6 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009990-A01 |
| Product name: | SLC12A6 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC12A6. |
| Gene id: | 9990 |
| Gene name: | SLC12A6 |
| Gene alias: | ACCPN|DKFZp434D2135|KCC3|KCC3A|KCC3B |
| Gene description: | solute carrier family 12 (potassium/chloride transporters), member 6 |
| Genbank accession: | NM_005135 |
| Immunogen: | SLC12A6 (NP_005126, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEPDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMD |
| Protein accession: | NP_005126 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Potassium-chloride cotransporter 3 interacts with vav2 to synchronize the cell volume decrease response with cell protrusion dynamics.Salin-Cantegrel A, Shekarabi M, Rasheed S, Charron FM, Laganiere J, Gaudet R, Dion PA, Lapointe JY, Rouleau GA PLoS One. 2013 May 28;8(5):e65294. doi: 10.1371/journal.pone.0065294. Print 2013. |