CLEC2B purified MaxPab mouse polyclonal antibody (B01P) View larger

CLEC2B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CLEC2B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CLEC2B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009976-B01P
Product name: CLEC2B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CLEC2B protein.
Gene id: 9976
Gene name: CLEC2B
Gene alias: AICL|CLECSF2|HP10085|IFNRG1
Gene description: C-type lectin domain family 2, member B
Genbank accession: BC005254
Immunogen: CLEC2B (AAH05254, 1 a.a. ~ 149 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEETNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICKKRIH
Protein accession: AAH05254
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009976-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CLEC2B expression in transfected 293T cell line (H00009976-T01) by CLEC2B MaxPab polyclonal antibody.

Lane 1: CLEC2B transfected lysate(16.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CLEC2B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart