Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00009975-B01 |
Product name: | NR1D2 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human NR1D2 protein. |
Gene id: | 9975 |
Gene name: | NR1D2 |
Gene alias: | BD73|EAR-1r|HZF2|Hs.37288|RVR |
Gene description: | nuclear receptor subfamily 1, group D, member 2 |
Genbank accession: | NM_005126.2 |
Immunogen: | NR1D2 (NP_005117.2, 1 a.a. ~ 579 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP |
Protein accession: | NP_005117.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NR1D2 expression in transfected 293T cell line (H00009975-T01) by NR1D2 MaxPab polyclonal antibody. Lane1:NR1D2 transfected lysate(63.69 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |