Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCS monoclonal antibody (M03), clone 1E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about CCS monoclonal antibody (M03), clone 1E2
| Brand: | Abnova |
| Reference: | H00009973-M03 |
| Product name: | CCS monoclonal antibody (M03), clone 1E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CCS. |
| Clone: | 1E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9973 |
| Gene name: | CCS |
| Gene alias: | MGC138260 |
| Gene description: | copper chaperone for superoxide dismutase |
| Genbank accession: | NM_005125 |
| Immunogen: | CCS (NP_005116, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
| Protein accession: | NP_005116 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CCS on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.5 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Impaired Copper and Iron Metabolism in Blood Cells and Muscles of Patients Affected by Copper Deficiency Myeloneuropathy.Spinazzi M, Sghirlanzoni A, Salviati L, Angelini C. Neuropathol Appl Neurobiol. 2014 Dec;40(7):888-98. |