No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009968-A01 |
Product name: | MED12 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MED12. |
Gene id: | 9968 |
Gene name: | MED12 |
Gene alias: | CAGH45|FGS1|HOPA|KIAA0192|OKS|OPA1|TNRC11|TRAP230 |
Gene description: | mediator complex subunit 12 |
Genbank accession: | NM_005120 |
Immunogen: | MED12 (NP_005111, 1829 a.a. ~ 1941 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVP |
Protein accession: | NP_005111 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.54 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Distinct alternative splicing patterns of mediator subunit genes during endothelial progenitor cell differentiation.Rienzo M, Casamassimi A, Schiano C, Grimaldi V, Infante T, Napoli C. Biochimie. 2012 Apr 16. |