> >>TNFSF15 monoclonal antibody (M06), clone 2H3
TNFSF15 monoclonal antibody (M06), clone 2H3 View larger

TNFSF15 monoclonal antibody (M06), clone 2H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of TNFSF15 monoclonal antibody (M06), clone 2H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNFSF15 monoclonal antibody (M06), clone 2H3

Brand: Abnova
Reference: H00009966-M06
Product name: TNFSF15 monoclonal antibody (M06), clone 2H3
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFSF15.
Clone: 2H3
Isotype: IgG1 Kappa
Gene id: 9966
Gene name: TNFSF15
Gene alias: MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene description: tumor necrosis factor (ligand) superfamily, member 15
Genbank accession: BC074941.2
Immunogen: TNFSF15 (AAH74941.1, 72 a.a. ~ 251 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Protein accession: AAH74941.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009966-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFSF15 monoclonal antibody (M06), clone 2H3 now

Add to cart