View larger

TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00009966-D01P
Product name:	TNFSF15 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human TNFSF15 protein.
Gene id:	9966
Gene name:	TNFSF15
Gene alias:	MGC129934\|MGC129935\|TL1\|TL1A\|VEGI\|VEGI192A
Gene description:	tumor necrosis factor (ligand) superfamily, member 15
Genbank accession:	NM_005118
Immunogen:	TNFSF15 (NP_005109.2, 1 a.a. ~ 251 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Protein accession:	NP_005109.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of TNFSF15 expression in transfected 293T cell line (H00009966-T02) by TNFSF15 MaxPab polyclonal antibody. Lane 1: TNFSF15 transfected lysate(28.10 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice