HS3ST1 purified MaxPab mouse polyclonal antibody (B01P) View larger

HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009957-B01P
Product name: HS3ST1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HS3ST1 protein.
Gene id: 9957
Gene name: HS3ST1
Gene alias: 3OST|3OST1
Gene description: heparan sulfate (glucosamine) 3-O-sulfotransferase 1
Genbank accession: NM_005114.2
Immunogen: HS3ST1 (NP_005105.1, 1 a.a. ~ 307 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH
Protein accession: NP_005105.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009957-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HS3ST1 expression in transfected 293T cell line (H00009957-T01) by HS3ST1 MaxPab polyclonal antibody.

Lane 1: HS3ST1 transfected lysate(33.77 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HS3ST1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart