Brand: | Abnova |
Reference: | H00009943-M10 |
Product name: | OXSR1 monoclonal antibody (M10), clone 3F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OXSR1. |
Clone: | 3F6 |
Isotype: | IgG3 Kappa |
Gene id: | 9943 |
Gene name: | OXSR1 |
Gene alias: | KIAA1101|OSR1 |
Gene description: | oxidative-stress responsive 1 |
Genbank accession: | BC008726.1 |
Immunogen: | OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI |
Protein accession: | AAH08726.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | OXSR1 monoclonal antibody (M10), clone 3F6 Western Blot analysis of OXSR1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Impaired degradation of WNK1 and WNK4 kinases causes PHAII in mutant KLHL3 knock-in mice.Susa K, Sohara E, Rai T, Zeniya M, Mori Y, Mori T, Chiga M, Nomura N, Nishida H, Takahashi D, Isobe K, Inoue Y, Takeishi K, Takeda N, Sasaki S, Uchida S Hum Mol Genet. 2014 May 12. pii: ddu217. |