| Reference: | H00009943-M06J |
| Product name: | OXSR1 monoclonal antibody (M06J), clone 1C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OXSR1. |
| Clone: | 1C8 |
| Isotype: | IgG3 Kappa |
| Gene id: | 9943 |
| Gene name: | OXSR1 |
| Gene alias: | KIAA1101|OSR1 |
| Gene description: | oxidative-stress responsive 1 |
| Genbank accession: | BC008726.1 |
| Immunogen: | OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI |
| Protein accession: | AAH08726.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |