No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00009943-M04 |
Product name: | OXSR1 monoclonal antibody (M04), clone 4G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OXSR1. |
Clone: | 4G9 |
Isotype: | IgG2a Kappa |
Gene id: | 9943 |
Gene name: | OXSR1 |
Gene alias: | KIAA1101|OSR1 |
Gene description: | oxidative-stress responsive 1 |
Genbank accession: | BC008726.1 |
Immunogen: | OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI |
Protein accession: | AAH08726.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to OXSR1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |