| Brand: | Abnova |
| Reference: | H00009941-M02 |
| Product name: | ENDOGL1 monoclonal antibody (M02), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ENDOGL1. |
| Clone: | 2F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9941 |
| Gene name: | EXOG |
| Gene alias: | ENDOGL1|ENDOGL2|ENGL|ENGL-B|ENGL-a|MGC125944|MGC125945 |
| Gene description: | endo/exonuclease (5'-3'), endonuclease G-like |
| Genbank accession: | NM_005107 |
| Immunogen: | ENDOGL1 (NP_005098.1, 269 a.a. ~ 368 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS |
| Protein accession: | NP_005098.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ENDOGL1 monoclonal antibody (M02), clone 2F7. Western Blot analysis of ENDOGL1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |