ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P) View larger

ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009938-B01P
Product name: ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ARHGAP25 protein.
Gene id: 9938
Gene name: ARHGAP25
Gene alias: KAIA0053
Gene description: Rho GTPase activating protein 25
Genbank accession: BC039591.1
Immunogen: ARHGAP25 (AAH39591.1, 1 a.a. ~ 458 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSILPRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMVRCREPSCFHWVLPLVQAIPCKACSRVAIWGVLGDAVAVGAAATDSSEHTLKAWPLSKSSFYWHL
Protein accession: AAH39591.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009938-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ARHGAP25 expression in transfected 293T cell line (H00009938-T01) by ARHGAP25 MaxPab polyclonal antibody.

Lane1:ARHGAP25 transfected lysate(50.38 KDa).
Lane2:Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ARHGAP25 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart