No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Reference: | H00009931-M02 |
Product name: | HELZ monoclonal antibody (M02), clone 5B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HELZ. |
Clone: | 5B2 |
Isotype: | IgG2b Kappa |
Gene id: | 9931 |
Gene name: | HELZ |
Gene alias: | DHRC|DKFZp586G1924|DRHC|HUMORF5|KIAA0054|MGC163454 |
Gene description: | helicase with zinc finger |
Genbank accession: | NM_014877 |
Immunogen: | HELZ (NP_055692, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC |
Protein accession: | NP_055692 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |