Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CNAP1 monoclonal antibody (M02), clone 4C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CNAP1 monoclonal antibody (M02), clone 4C9
| Brand: | Abnova |
| Reference: | H00009918-M02 |
| Product name: | CNAP1 monoclonal antibody (M02), clone 4C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CNAP1. |
| Clone: | 4C9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9918 |
| Gene name: | NCAPD2 |
| Gene alias: | CAP-D2|CNAP1|KIAA0159|hCAP-D2 |
| Gene description: | non-SMC condensin I complex, subunit D2 |
| Genbank accession: | BC028182 |
| Immunogen: | CNAP1 (AAH28182, 1240 a.a. ~ 1339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT |
| Protein accession: | AAH28182 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |