CNAP1 polyclonal antibody (A01) View larger

CNAP1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNAP1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CNAP1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009918-A01
Product name: CNAP1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CNAP1.
Gene id: 9918
Gene name: NCAPD2
Gene alias: CAP-D2|CNAP1|KIAA0159|hCAP-D2
Gene description: non-SMC condensin I complex, subunit D2
Genbank accession: BC028182
Immunogen: CNAP1 (AAH28182, 1240 a.a. ~ 1339 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LRKMLDNFDCFGDKLSDESIFSAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSSGSRYQPLASTASDNDFVT
Protein accession: AAH28182
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009918-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CNAP1 polyclonal antibody (A01) now

Add to cart